DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and SPINK7

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_115955.1 Gene:SPINK7 / 84651 HGNCID:24643 Length:85 Species:Homo sapiens


Alignment Length:182 Identity:37/182 - (20%)
Similarity:61/182 - (33%) Gaps:69/182 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 IRDSHAVTRPYICIQCNKGFLRRSDLKKH-----TFVHT---GVRPYACDQCGKSFSRNTNL--- 243
            :|||...:     ||   |||  :|::.|     |..||   .||.::.:.     |..|.|   
Human    24 LRDSRGSS-----IQ---GFL--ADVEVHGSSRLTRTHTLRYNVRAHSLEG-----SEKTQLLVL 73

  Fly   244 --------KKHMRTHLGVKPHGC--------DLCPRSFAN-----------KADLIRHRSFHHAQ 281
                    .|:.......:|.||        :.|.|...|           .|::|..:|  ..:
Human    74 IYVDEELFLKYNGDSRETEPLGCWIKGHGGNETCARETNNLLKVEEKLRGMMAEVINQKS--QEE 136

  Fly   282 ETQH----ACIRCGAVYTQKDKLYDHERYCMGKPLAFGMGEMVKQEPAPFGL 329
            ..:|    :.::...|.::..|:...   |:|:       ......|..|||
Human   137 GAEHWIVPSRLKSQGVRSRDKKVTSS---CLGR-------ARPSHSPGNFGL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052
SPINK7NP_115955.1 KAZAL_PSTI 41..85 CDD:238648 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.