DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and SPINK2

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001258647.1 Gene:SPINK2 / 6691 HGNCID:11245 Length:134 Species:Homo sapiens


Alignment Length:37 Identity:13/37 - (35%)
Similarity:21/37 - (56%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VCGSNGVTFKNRCEFECSQRDYKKLGRTLNIRKDGPC 73
            ||||:..|:.|.|.. |.:  .::.|..:.|.::|||
Human   101 VCGSDMSTYANECTL-CMK--IREGGHNIKIIRNGPC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052 11/35 (31%)
SPINK2NP_001258647.1 Kazal_1 86..134 CDD:395004 11/35 (31%)

Return to query results.
Submit another query.