DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and spink2.1

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001185680.1 Gene:spink2.1 / 565497 ZFINID:ZDB-GENE-070112-972 Length:77 Species:Danio rerio


Alignment Length:55 Identity:15/55 - (27%)
Similarity:27/55 - (49%) Gaps:9/55 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYLTLLLVLGLLIALFAGSSEGSYCP-CD------LKTKGTQVCGSNGVTFKNRC 49
            :::.:|....|:.|  |...:||..| |.      .:...:.|||::|:|:.|.|
Zfish     4 RFVLVLCFAALVRA--AAIPDGSIVPNCSQYSLPICQRDYSPVCGTDGLTYSNEC 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052 7/13 (54%)
spink2.1NP_001185680.1 Kazal_1 29..77 CDD:395004 8/28 (29%)

Return to query results.
Submit another query.