DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and Spink7

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_017173429.1 Gene:Spink7 / 408198 MGIID:3644691 Length:92 Species:Mus musculus


Alignment Length:72 Identity:23/72 - (31%)
Similarity:35/72 - (48%) Gaps:23/72 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLLLVLGLLIALFAGS-----SEGSYCP-----CDLKTK-----------GTQVCGSNGVTFKNR 48
            |:.||.|||: |||.:     ||.:..|     ||:..|           ...||||:.:|:.|:
Mouse    21 TMKLVGGLLL-LFAATYVCNCSEVTSHPSATVDCDIYKKYPVVAIPCPIVNIPVCGSDYITYGNK 84

  Fly    49 CEFECSQ 55
            |:. |::
Mouse    85 CKL-CTE 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052 8/19 (42%)
Spink7XP_017173429.1 KAZAL_FS 62..>92 CDD:412159 8/30 (27%)

Return to query results.
Submit another query.