powered by:
Protein Alignment Peritrophin-15a and CG3348
DIOPT Version :9
Sequence 1: | NP_524983.1 |
Gene: | Peritrophin-15a / 50433 |
FlyBaseID: | FBgn0040959 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001303428.1 |
Gene: | CG3348 / 50082 |
FlyBaseID: | FBgn0040609 |
Length: | 98 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 23/66 - (34%) |
Similarity: | 33/66 - (50%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 PNSDN-QPDCSDASNVQTNIRNFWDPTRYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSW 88
|:..| :|.|.....|....||:||||.||.|:...:.|....||.|..:......||.:::|:|
Fly 15 PHEHNGEPSCQGLDEVNRMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAW 79
Fly 89 T 89
|
Fly 80 T 80
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Peritrophin-15a | NP_524983.1 |
None |
CG3348 | NP_001303428.1 |
ChtBD2 |
24..73 |
CDD:214696 |
16/48 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45449161 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2F5S7 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20987 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.