DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-15a and CG34282

DIOPT Version :9

Sequence 1:NP_524983.1 Gene:Peritrophin-15a / 50433 FlyBaseID:FBgn0040959 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001097830.1 Gene:CG34282 / 42248 FlyBaseID:FBgn0085311 Length:94 Species:Drosophila melanogaster


Alignment Length:86 Identity:27/86 - (31%)
Similarity:40/86 - (46%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNFWDPTRYWWCESSTSTATAVLC 67
            |.:..:.|..|:||.|..|..|..:  :|:|:...:.....|:..|||.||.|......|..:.|
  Fly     5 SIICCLLLGLFLALSSAYNGQDIYA--EPNCAIVEDHARKFRDISDPTHYWVCPEGQEKADYIQC 67

  Fly    68 PLSTGFDPTKKECVSWSEWSW 88
            |.:..|...::.||.|.||.|
  Fly    68 PDNYAFMEQQQNCVVWEEWKW 88



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5S7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.