DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-15a and CG14246

DIOPT Version :10

Sequence 1:NP_524983.1 Gene:Peritrophin-15a / 50433 FlyBaseID:FBgn0040959 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_652260.1 Gene:CG14246 / 3772140 FlyBaseID:FBgn0040608 Length:93 Species:Drosophila melanogaster


Alignment Length:76 Identity:22/76 - (28%)
Similarity:31/76 - (40%) Gaps:14/76 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DNQPDCSDASNVQTNIRNFWDPTRYWWCESST--------------STATAVLCPLSTGFDPTKK 78
            :.:|.|..|..:..:.|:|||||.||.|...:              ..|....||.:..|...::
  Fly     7 NGEPGCRSAEELGQSYRHFWDPTAYWQCGGKSMEEERERDRDWERERPAQLQRCPANELFYDRER 71

  Fly    79 ECVSWSEWSWT 89
            .||.|..|.||
  Fly    72 RCVKWKHWQWT 82

Return to query results.
Submit another query.