powered by:
Protein Alignment Peritrophin-15b and CG14245
DIOPT Version :9
Sequence 1: | NP_001260249.1 |
Gene: | Peritrophin-15b / 50432 |
FlyBaseID: | FBgn0040958 |
Length: | 93 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001287548.1 |
Gene: | CG14245 / 3772449 |
FlyBaseID: | FBgn0039452 |
Length: | 103 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 28/63 - (44%) |
Gaps: | 4/63 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 GEPDC-VGRSGEIS--RDFWDPTHYWQCSSTG-QAELVACEQNTGFDPKTGSCVDWSVWQWYP 86
|:|.| .....|:: ..|:..:.||.||:.| .|.|..|...:.:.....:||.|..|.|.|
Fly 29 GQPGCQTAEELEVAFYAHFYLKSSYWVCSTQGVPATLAQCPIASAWLDSAKACVPWPQWVWSP 91
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45449172 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20987 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.