DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-15b and CG14300

DIOPT Version :10

Sequence 1:NP_524982.1 Gene:Peritrophin-15b / 50432 FlyBaseID:FBgn0040958 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001014639.1 Gene:CG14300 / 3346166 FlyBaseID:FBgn0038643 Length:94 Species:Drosophila melanogaster


Alignment Length:90 Identity:21/90 - (23%)
Similarity:34/90 - (37%) Gaps:6/90 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAALVLLFLTLCVAIYADLDCNPDGNGEPDCVGRS--GEISRDFWDPTHYWQCSSTG-QAELVA 62
            ||:.:.|....|.:.:.|.:..:.   |...|...|  |:.....:|...||.|.:.| .|..|.
  Fly     1 MKSVVALFATVLAIILVAGVSADA---GRSACKDESEIGQTYTHHFDAAKYWLCETLGVPATEVD 62

  Fly    63 CEQNTGFDPKTGSCVDWSVWQWYPP 87
            |.....:......|:.|:.:.|..|
  Fly    63 CPAGLAYMHLLKECIPWASYIWKKP 87

Return to query results.
Submit another query.