powered by:
Protein Alignment Sem1 and DSS1(V)
DIOPT Version :9
Sequence 1: | NP_652555.1 |
Gene: | Sem1 / 50428 |
FlyBaseID: | FBgn0266666 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199314.1 |
Gene: | DSS1(V) / 834532 |
AraportID: | AT5G45010 |
Length: | 73 |
Species: | Arabidopsis thaliana |
Alignment Length: | 53 |
Identity: | 29/53 - (54%) |
Similarity: | 41/53 - (77%) |
Gaps: | 2/53 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 LLEEDDEFEEFPA-EDFRVGDDEEELNV-WEDNWDDDNVEDDFSQQLKAHLES 74
|.|:|||||||.. ||:...::.:|::: |||:||||:|.||||:|||..||:
plant 16 LFEDDDEFEEFEINEDWLEKEEVKEVSLQWEDDWDDDDVSDDFSRQLKKELEN 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Sem1 | NP_652555.1 |
DSS1_SEM1 |
<43..73 |
CDD:398704 |
16/30 (53%) |
DSS1(V) | NP_199314.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4764 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG57872 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16771 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4102 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.010 |
|
Return to query results.
Submit another query.