DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sem1 and DSS1(V)

DIOPT Version :9

Sequence 1:NP_652555.1 Gene:Sem1 / 50428 FlyBaseID:FBgn0266666 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_199314.1 Gene:DSS1(V) / 834532 AraportID:AT5G45010 Length:73 Species:Arabidopsis thaliana


Alignment Length:53 Identity:29/53 - (54%)
Similarity:41/53 - (77%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEEDDEFEEFPA-EDFRVGDDEEELNV-WEDNWDDDNVEDDFSQQLKAHLES 74
            |.|:|||||||.. ||:...::.:|::: |||:||||:|.||||:|||..||:
plant    16 LFEDDDEFEEFEINEDWLEKEEVKEVSLQWEDDWDDDDVSDDFSRQLKKELEN 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sem1NP_652555.1 DSS1_SEM1 <43..73 CDD:398704 16/30 (53%)
DSS1(V)NP_199314.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4764
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57872
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16771
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4102
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.