DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sem1 and SEM1

DIOPT Version :9

Sequence 1:NP_652555.1 Gene:Sem1 / 50428 FlyBaseID:FBgn0266666 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001380827.1 Gene:SEM1 / 7979 HGNCID:10845 Length:120 Species:Homo sapiens


Alignment Length:49 Identity:38/49 - (77%)
Similarity:44/49 - (89%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLGLLEEDDEFEEFPAEDFRVGDDEEELNVWEDNWDDDNVEDDFSQQLK 69
            ||||||||||||||||||:...|::|:.:||||||||||||||||.||:
Human     9 DLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLR 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sem1NP_652555.1 DSS1_SEM1 <43..73 CDD:398704 20/27 (74%)
SEM1NP_001380827.1 DSS1_Sem1 <23..57 CDD:259841 23/33 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2495
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.990

Return to query results.
Submit another query.