DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sem1 and dss-1

DIOPT Version :9

Sequence 1:NP_652555.1 Gene:Sem1 / 50428 FlyBaseID:FBgn0266666 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001370842.1 Gene:dss-1 / 175284 WormBaseID:WBGene00022492 Length:82 Species:Caenorhabditis elegans


Alignment Length:48 Identity:25/48 - (52%)
Similarity:37/48 - (77%) Gaps:2/48 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDDEFEEFPAEDF--RVGDDEEELNVWEDNWDDDNVEDDFSQQLKAHL 72
            |::||||||.:::  |...:|:::|||||||||:..|.:||:|||..|
 Worm    27 EEEEFEEFPVQEWAERAEGEEDDVNVWEDNWDDETHESEFSKQLKEEL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sem1NP_652555.1 DSS1_SEM1 <43..73 CDD:398704 17/30 (57%)
dss-1NP_001370842.1 DSS1_Sem1 <35..77 CDD:259841 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4764
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106980
Panther 1 1.100 - - LDO PTHR16771
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2495
SonicParanoid 1 1.000 - - X4102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.