powered by:
Protein Alignment Sem1 and dss-1
DIOPT Version :9
Sequence 1: | NP_652555.1 |
Gene: | Sem1 / 50428 |
FlyBaseID: | FBgn0266666 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370842.1 |
Gene: | dss-1 / 175284 |
WormBaseID: | WBGene00022492 |
Length: | 82 |
Species: | Caenorhabditis elegans |
Alignment Length: | 48 |
Identity: | 25/48 - (52%) |
Similarity: | 37/48 - (77%) |
Gaps: | 2/48 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 EDDEFEEFPAEDF--RVGDDEEELNVWEDNWDDDNVEDDFSQQLKAHL 72
|::||||||.::: |...:|:::|||||||||:..|.:||:|||..|
Worm 27 EEEEFEEFPVQEWAERAEGEEDDVNVWEDNWDDETHESEFSKQLKEEL 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4764 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006435 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_106980 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR16771 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2495 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4102 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.840 |
|
Return to query results.
Submit another query.