DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Cht4

DIOPT Version :10

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_524962.2 Gene:Cht4 / 49815 FlyBaseID:FBgn0022700 Length:462 Species:Drosophila melanogaster


Alignment Length:111 Identity:28/111 - (25%)
Similarity:32/111 - (28%) Gaps:34/111 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VSGVSGSSKARPSSVKVRPARPVRPAVRPALEIDELSAPK----------AQELTMSTYTKYVCR 416
            |||.||..........|.||....|...|.      .||.          ||             
  Fly   375 VSGGSGGGGGGGGEGSVTPAPTAAPTSSPT------PAPTPGGGSGGNECAQ------------- 420

  Fly   417 NKPDGFMLASLKSCSDYYICRYGKPLLVSCG-DKYFNALKGICDLP 461
               |||.:.. ..|:.:|.|..|......|| ...||.:...||.|
  Fly   421 ---DGFFVLE-SDCNKFYQCVGGVRYDFQCGAGLCFNTITLNCDWP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:426342
CBM_14 415..463 CDD:426342 14/48 (29%)
Cht4NP_524962.2 GH18_chitolectin_chitotriosidase 26..371 CDD:119351
CBM_14 420..462 CDD:426342 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.