DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and obst-F

DIOPT Version :9

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:140 Identity:39/140 - (27%)
Similarity:57/140 - (40%) Gaps:31/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 TPATTTTCVPETTTSCASSTTTTECGPVSGVSGSSKARP-----SSVKVRPARPVRPAVRPALEI 394
            |...||..||  |.:...:.|      |..:.|||:...     :|.::....||.|...|..|.
  Fly   211 TDVETTMKVP--TANSEGAVT------VCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEA 267

  Fly   395 DELSAPKAQELTMSTYTKYVCRNKPDGFMLASLKSCSDYYICRYGKPLLVSCGDKYF-NALKGIC 458
            :.|:.|..::..||         .|:        .||.||||..|.|:|.||....| :...|.|
  Fly   268 NALTCPSTKQSYMS---------HPE--------DCSKYYICIGGMPVLTSCPKGLFWDQKSGFC 315

  Fly   459 DLPENTRCVQ 468
            ::.:|.:|.|
  Fly   316 EMEKNVKCFQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884 15/48 (31%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884
CBM_14 272..321 CDD:279884 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.