powered by:
Protein Alignment Muc26B and T01C4.8
DIOPT Version :9
Sequence 1: | NP_652552.1 |
Gene: | Muc26B / 50424 |
FlyBaseID: | FBgn0040950 |
Length: | 471 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033501.1 |
Gene: | T01C4.8 / 3896840 |
WormBaseID: | WBGene00044546 |
Length: | 122 |
Species: | Caenorhabditis elegans |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 17/44 - (38%) |
Gaps: | 9/44 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 YVCVYKP-DGFRALVPGSCSQYYECQSGVALVNVCSRFFDAKAQ 83
|.|| | |..|...|.:..:..:.|.|. |..||..||
Worm 46 YKCV--PIDDVRWWTPENSDENRQGQCGK------SAPFDKTAQ 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Muc26B | NP_652552.1 |
CBM_14 |
43..86 |
CDD:279884 |
13/42 (31%) |
CBM_14 |
415..463 |
CDD:279884 |
|
T01C4.8 | NP_001033501.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.