DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Cht2

DIOPT Version :10

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_477298.2 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster


Alignment Length:35 Identity:11/35 - (31%)
Similarity:16/35 - (45%) Gaps:7/35 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 VKVRPAR-----PVRPAVRPA--LEIDELSAPKAQ 403
            |...|.|     |:...:..|  |.:|||:.|:.|
  Fly   408 VTAAPKRSSQNYPLLRTINEATMLAVDELAVPEPQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:426342
CBM_14 415..463 CDD:426342
Cht2NP_477298.2 GH18_chitolectin_chitotriosidase 43..428 CDD:119351 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.