DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Idgf3

DIOPT Version :9

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster


Alignment Length:79 Identity:20/79 - (25%)
Similarity:28/79 - (35%) Gaps:14/79 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 GPVSGVSG--------SSKARPSSVKVR-PARPVRPAVRPALEIDELSAPKAQELTMSTYTKYVC 415
            ||.|...|        |....||:...| |..||:..|.|.......:...|.|  ...:..::.
  Fly   327 GPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADE--NGDHGLWIS 389

  Fly   416 RNKPDGFMLASLKS 429
            .:.||.   ||.|:
  Fly   390 YDDPDS---ASSKA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884 5/15 (33%)
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 20/79 (25%)
Glyco_18 27..419 CDD:214753 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.