DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Muc96D

DIOPT Version :9

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_733106.2 Gene:Muc96D / 318737 FlyBaseID:FBgn0051439 Length:881 Species:Drosophila melanogaster


Alignment Length:897 Identity:289/897 - (32%)
Similarity:329/897 - (36%) Gaps:452/897 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YAIVIACAALAVASINAASVQPVVQPGVRAIDNQLYRRYVCVYKPDGFRALVPGSCSQYYECQSG 67
            ||..:...|:..::.:.|||..:                :|..|.:|.|||||||||::||||:|
  Fly     5 YAFALLLIAVFASTSSGASVSDL----------------LCRNKANGIRALVPGSCSRFYECQNG 53

  Fly    68 VALVNVCSRFFDAKAQGCVNYNTGCIE---FQPASASS------PVGGSIAA-VPCAEETTTCAP 122
            ||....|.:|:|.|.:.||.|||||:|   .:|.:..|      |..|:... .|||..|..|..
  Fly    54 VAKEYTCPKFYDFKIRSCVTYNTGCVEGVVVKPVAQQSVRDTAQPCNGATTTPPPCATTTPPCTK 118

  Fly   123 Q--------IITTTTCTPAS-VTTTTTCAPTTTTTCA---------PTTTTTCAP---------- 159
            .        |||:||.|||| .||||||.||||||.:         .||||||.|          
  Fly   119 TTTQTPCSGIITSTTTTPASTTTTTTTCTPTTTTTTSTTTTTTTTTTTTTTTCTPTTTTTTTTTT 183

  Fly   160 ---------------TTTTTCAP-------------------------TTTTTCAP--------- 175
                           ||||||.|                         ||||||.|         
  Fly   184 TTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTT 248

  Fly   176 ----------TTTTTCAP-----------------TTTTTCAP---------------------- 191
                      ||||||.|                 ||||||.|                      
  Fly   249 TTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTT 313

  Fly   192 ---TTTTTCAP-------------------------TTTTTCAP-------------------TT 209
               ||||||.|                         ||||||.|                   ||
  Fly   314 TTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTT 378

  Fly   210 TTTCAP--------------TTTTTCAP-----------------------TTTTTCAP------ 231
            ||||.|              ||||||.|                       ||||||.|      
  Fly   379 TTTCTPTTTTTTTTTTTTTTTTTTTCTPTTTTTTTSTTTTTTTTTTTTTTTTTTTTCTPTTTTTT 443

  Fly   232 -----------TTTTTCAP----------------------TTTTTCAP-----------TTTTT 252
                       ||||||.|                      ||||||.|           |||||
  Fly   444 TTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTT 508

  Fly   253 CAPTTTTTCAP-----------------TTTTTCAPT----------------------TTTTCA 278
            ..|||||||.|                 ||||||.||                      |||||.
  Fly   509 TTPTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTATTTPTTTTCT 573

  Fly   279 P-------------------TTTTTCAP----------------------TTTTTCAP------- 295
            |                   ||||||.|                      ||||||.|       
  Fly   574 PTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTTTTTTTTTTCTPTTTTTTT 638

  Fly   296 ------------TTTTTCAP-----------TTTTTCAP-------------------------- 311
                        ||||||.|           ||||||.|                          
  Fly   639 TTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTCTPTTTTTTTTTTTTTTTTTTCTTTTTTT 703

  Fly   312 --------TTTTTCAPTTTTTCTP-GITTTTCTPATTTTCVPETTTSCASST-----------TT 356
                    |||||||||||||||| ..|||||.|.|::|....|||:|.|.|           ||
  Fly   704 TTTTTTTTTTTTTCAPTTTTTCTPTTTTTTTCAPTTSSTTTTSTTTTCTSKTISTTTCPETAPTT 768

  Fly   357 TECGPVSGVSGSSKARPSSVKVRPARPVR--PAVRPALEIDE---LSAPKAQELTMSTYTKYVCR 416
            |.|..|:.....::::..:.......|||  |..|...|:.|   ||:..::     ...|..|.
  Fly   769 TACSDVTTTVCPTESKAVAATQSKRNPVRRNPVNRLLWEVAEWAGLSSSSSE-----AQLKVSCL 828

  Fly   417 NKPDGFMLASLKSCSDYYICRYGKPLLVSCGDKYFNALKGICDLPENTRCVQ 468
            .|||||::||.:.|:||||||:.:.|.|||||:|||.|||||||||||.|||
  Fly   829 GKPDGFLMASPERCNDYYICRHQRALKVSCGDRYFNGLKGICDLPENTSCVQ 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884 23/42 (55%)
CBM_14 415..463 CDD:279884 32/47 (68%)
Muc96DNP_733106.2 ChtBD2 29..72 CDD:214696 23/42 (55%)
CBM_14 827..875 CDD:279884 32/47 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.