DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Chial1

DIOPT Version :10

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001426353.1 Gene:Chial1 / 295352 RGDID:1309110 Length:440 Species:Rattus norvegicus


Alignment Length:50 Identity:14/50 - (28%)
Similarity:24/50 - (48%) Gaps:6/50 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 LEIDELSAPKAQELTMSTYTKYVCRNKPDGFMLASLKSCSDYYICRYGKP 441
            |.|..:|.|:::...:::..|::.:...||..||     ..|..| ||.|
  Rat   122 LFITMVSTPESRHTFITSVRKFLRKYGFDGLNLA-----WQYPGC-YGSP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:426342
CBM_14 415..463 CDD:426342 8/26 (31%)
Chial1NP_001426353.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.