powered by:
Protein Alignment Muc26B and RGD1309110
DIOPT Version :9
Sequence 1: | NP_652552.1 |
Gene: | Muc26B / 50424 |
FlyBaseID: | FBgn0040950 |
Length: | 471 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006233175.1 |
Gene: | RGD1309110 / 295352 |
RGDID: | 1309110 |
Length: | 440 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 14/50 - (28%) |
Similarity: | 24/50 - (48%) |
Gaps: | 6/50 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 392 LEIDELSAPKAQELTMSTYTKYVCRNKPDGFMLASLKSCSDYYICRYGKP 441
|.|..:|.|:::...:::..|::.:...||..|| ..|..| ||.|
Rat 122 LFITMVSTPESRHTFITSVRKFLRKYGFDGLNLA-----WQYPGC-YGSP 165
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.