DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Chil6

DIOPT Version :9

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 / 229688 MGIID:2682303 Length:452 Species:Mus musculus


Alignment Length:88 Identity:21/88 - (23%)
Similarity:31/88 - (35%) Gaps:17/88 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VRPALEIDELSAPKAQELTMSTYTKYVCRNKPDGFMLASLKSCSDY-YICRY------------G 439
            :|.|.| .|:|..|...|.::.....|......|:.:..|....|| .:..|            .
Mouse   191 IRKAFE-KEVSKNKKPRLMVTAAVAGVISTIQFGYEIPQLSQSLDYIQVMTYDLHGSWDGYTGEN 254

  Fly   440 KPLL---VSCGDKYFNALKGICD 459
            .||.   :..|.|.|:.:|.|.|
Mouse   255 SPLYKSPIETGVKAFHNIKYIMD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884 13/61 (21%)
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 21/88 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.