powered by:
Protein Alignment Muc26B and chil-16
DIOPT Version :9
Sequence 1: | NP_652552.1 |
Gene: | Muc26B / 50424 |
FlyBaseID: | FBgn0040950 |
Length: | 471 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496020.1 |
Gene: | chil-16 / 187732 |
WormBaseID: | WBGene00011158 |
Length: | 440 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 15/55 - (27%) |
Similarity: | 25/55 - (45%) |
Gaps: | 9/55 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 KYAIVIACAALAVASI----NAASVQPVVQPGV---RAIDNQLYRRYVCVYKPDG 49
|.|.::...|..:.|| |.....|::|... :.||:.:| ::..||.||
Worm 140 KLASILKFDAKIMFSIGGPANTQFFSPIIQNEEMKRKFIDSIIY--FLKQYKLDG 192
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Muc26B | NP_652552.1 |
CBM_14 |
43..86 |
CDD:279884 |
4/7 (57%) |
CBM_14 |
415..463 |
CDD:279884 |
|
chil-16 | NP_496020.1 |
Glyco_18 |
87..411 |
CDD:214753 |
15/55 (27%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.