| Sequence 1: | NP_652552.1 | Gene: | Muc26B / 50424 | FlyBaseID: | FBgn0040950 | Length: | 471 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031721.2 | Gene: | Chi3l1 / 12654 | MGIID: | 1340899 | Length: | 389 | Species: | Mus musculus |
| Alignment Length: | 32 | Identity: | 12/32 - (37%) |
|---|---|---|---|
| Similarity: | 16/32 - (50%) | Gaps: | 1/32 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 408 STYTKYVCRNKPDGF-MLASLKSCSDYYICRY 438 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Muc26B | NP_652552.1 | CBM_14 | 43..86 | CDD:426342 | |
| CBM_14 | 415..463 | CDD:426342 | 10/25 (40%) | ||
| Chi3l1 | NP_031721.2 | GH18_chitolectin_chitotriosidase | 32..388 | CDD:119351 | 1/4 (25%) |
| Important for AKT1 activation and IL8 production | 333..347 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||