DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and Chi3l1

DIOPT Version :10

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_031721.2 Gene:Chi3l1 / 12654 MGIID:1340899 Length:389 Species:Mus musculus


Alignment Length:32 Identity:12/32 - (37%)
Similarity:16/32 - (50%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 STYTKYVCRNKPDGF-MLASLKSCSDYYICRY 438
            ||..:...|....|| :|..|:|||.|.:..|
Mouse     4 STEARMGMRAALTGFAVLMLLQSCSAYKLVCY 35

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:426342
CBM_14 415..463 CDD:426342 10/25 (40%)
Chi3l1NP_031721.2 GH18_chitolectin_chitotriosidase 32..388 CDD:119351 1/4 (25%)
Important for AKT1 activation and IL8 production 333..347
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.