powered by:
Protein Alignment Muc26B and CHIT1
DIOPT Version :9
Sequence 1: | NP_652552.1 |
Gene: | Muc26B / 50424 |
FlyBaseID: | FBgn0040950 |
Length: | 471 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003456.1 |
Gene: | CHIT1 / 1118 |
HGNCID: | 1936 |
Length: | 466 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 32/75 - (42%) |
Gaps: | 3/75 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 383 PVRPAVRPALEIDELSAPKAQELTMSTYTKYVCRNKPDGFMLASLKSCSDYYICRYGKPLLVSC- 446
|..|:..|.||:.:...|...|...|......|:.|.|| :..:.:..|.:|.|..|:....||
Human 388 PYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFCQGKADG-LYPNPRERSSFYSCAAGRLFQQSCP 451
Fly 447 -GDKYFNALK 455
|..:.|:.|
Human 452 TGLVFSNSCK 461
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.