DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and chia.5

DIOPT Version :10

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001103511.2 Gene:chia.5 / 100003900 ZFINID:ZDB-GENE-071004-113 Length:481 Species:Danio rerio


Alignment Length:95 Identity:29/95 - (30%)
Similarity:37/95 - (38%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 TTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCA--- 318
            |....:.|...:..|:||...:.|:||..|....||..|...|  ||:.:..||..:....|   
Zfish   383 TLLNISNTDFPSLPPSTTDKASGTSTTASAAVPHTTIPPVVPT--APSGSDFCASRSEGIYANPA 445

  Fly   319 -PTTTTTCTPGITTTTCTPATTT-----TC 342
             |.|...|..|.|.....||||.     ||
Zfish   446 DPKTFIQCANGRTFIQNCPATTVFDPDCTC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:426342
CBM_14 415..463 CDD:426342
chia.5NP_001103511.2 GH18_chitolectin_chitotriosidase 23..381 CDD:119351
ChtBD2 431..479 CDD:214696 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.