DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc26B and chia.5

DIOPT Version :9

Sequence 1:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001103511.2 Gene:chia.5 / 100003900 ZFINID:ZDB-GENE-071004-113 Length:481 Species:Danio rerio


Alignment Length:95 Identity:29/95 - (30%)
Similarity:37/95 - (38%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 TTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCA--- 318
            |....:.|...:..|:||...:.|:||..|....||..|...|  ||:.:..||..:....|   
Zfish   383 TLLNISNTDFPSLPPSTTDKASGTSTTASAAVPHTTIPPVVPT--APSGSDFCASRSEGIYANPA 445

  Fly   319 -PTTTTTCTPGITTTTCTPATTT-----TC 342
             |.|...|..|.|.....||||.     ||
Zfish   446 DPKTFIQCANGRTFIQNCPATTVFDPDCTC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884
chia.5NP_001103511.2 Glyco_18 22..363 CDD:214753
GH18_chitolectin_chitotriosidase 23..381 CDD:119351
CBM_14 433..479 CDD:279884 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.