DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neb-cGP and ATP5MK

DIOPT Version :9

Sequence 1:NP_001259408.1 Gene:Neb-cGP / 50417 FlyBaseID:FBgn0083167 Length:48 Species:Drosophila melanogaster
Sequence 2:NP_001193355.1 Gene:ATP5MK / 84833 HGNCID:30889 Length:58 Species:Homo sapiens


Alignment Length:51 Identity:21/51 - (41%)
Similarity:30/51 - (58%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAG-EGE---KLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
            ||| |.:   :.||:.|.||..|::||.|...|||..:.|::.|..|:.||
Human     1 MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKK 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neb-cGPNP_001259408.1 ATP_synth_reg 1..47 CDD:373426 19/49 (39%)
ATP5MKNP_001193355.1 ATP_synth_reg 1..51 CDD:373426 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12381
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1629213at2759
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - LDO PTHR34038
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.