powered by:
Protein Alignment Neb-cGP and ATP5MK
DIOPT Version :9
Sequence 1: | NP_001259408.1 |
Gene: | Neb-cGP / 50417 |
FlyBaseID: | FBgn0083167 |
Length: | 48 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001193355.1 |
Gene: | ATP5MK / 84833 |
HGNCID: | 30889 |
Length: | 58 |
Species: | Homo sapiens |
Alignment Length: | 51 |
Identity: | 21/51 - (41%) |
Similarity: | 30/51 - (58%) |
Gaps: | 4/51 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAG-EGE---KLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
||| |.: :.||:.|.||..|::||.|...|||..:.|::.|..|:.||
Human 1 MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKK 51
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I12381 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1629213at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108639 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR34038 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.920 |
|
Return to query results.
Submit another query.