DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neb-cGP and atp5md

DIOPT Version :9

Sequence 1:NP_001259408.1 Gene:Neb-cGP / 50417 FlyBaseID:FBgn0083167 Length:48 Species:Drosophila melanogaster
Sequence 2:NP_001186962.1 Gene:atp5md / 794625 ZFINID:ZDB-GENE-110914-234 Length:58 Species:Danio rerio


Alignment Length:47 Identity:21/47 - (44%)
Similarity:30/47 - (63%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK 48
            ||...:.||::|.||..|::||.|...||||.:..:|.:..|||||:
Zfish     6 AGSQHQFTGIAKYFNSYTITGRRNCVLATYASIAAIILFFKLKPKKQ 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neb-cGPNP_001259408.1 ATP_synth_reg 1..47 CDD:373426 19/44 (43%)
atp5mdNP_001186962.1 ATP_synth_reg 1..51 CDD:291621 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12224
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5484
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1629213at2759
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 1 1.000 - - oto38783
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - LDO PTHR34038
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.