DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neb-cGP and Atp5md

DIOPT Version :9

Sequence 1:NP_001259408.1 Gene:Neb-cGP / 50417 FlyBaseID:FBgn0083167 Length:48 Species:Drosophila melanogaster
Sequence 2:NP_075700.2 Gene:Atp5md / 66477 MGIID:1891435 Length:58 Species:Mus musculus


Alignment Length:51 Identity:23/51 - (45%)
Similarity:32/51 - (62%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAG---EGE-KLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
            |||   :|: :.||:.|.||..|::||.|...|||..:.||:.|..|:|||
Mouse     1 MAGAESDGQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRPKK 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neb-cGPNP_001259408.1 ATP_synth_reg 1..47 CDD:373426 21/49 (43%)
Atp5mdNP_075700.2 ATP_synth_reg 1..51 CDD:373426 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12390
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I5504
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 1 1.000 - - oto94086
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - LDO PTHR34038
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.