powered by:
Protein Alignment Neb-cGP and Atp5md
DIOPT Version :9
Sequence 1: | NP_001259408.1 |
Gene: | Neb-cGP / 50417 |
FlyBaseID: | FBgn0083167 |
Length: | 48 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_075700.2 |
Gene: | Atp5md / 66477 |
MGIID: | 1891435 |
Length: | 58 |
Species: | Mus musculus |
Alignment Length: | 51 |
Identity: | 23/51 - (45%) |
Similarity: | 32/51 - (62%) |
Gaps: | 4/51 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAG---EGE-KLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
||| :|: :.||:.|.||..|::||.|...|||..:.||:.|..|:|||
Mouse 1 MAGAESDGQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRPKK 51
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
42 |
1.000 |
Domainoid score |
I12390 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
41 |
1.000 |
Inparanoid score |
I5504 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto94086 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108639 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR34038 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.960 |
|
Return to query results.
Submit another query.