DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neb-cGP and CG15458

DIOPT Version :9

Sequence 1:NP_001259408.1 Gene:Neb-cGP / 50417 FlyBaseID:FBgn0083167 Length:48 Species:Drosophila melanogaster
Sequence 2:NP_652293.1 Gene:CG15458 / 50124 FlyBaseID:FBgn0040651 Length:63 Species:Drosophila melanogaster


Alignment Length:37 Identity:18/37 - (48%)
Similarity:27/37 - (72%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK 48
            ::.||..||.|||||||||:|.:||:  |.::|..::
  Fly     8 NEAFNSQTMRGRANVAKATWASLGLV--YVLVKMHRR 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neb-cGPNP_001259408.1 ATP_synth_reg 1..47 CDD:373426 18/34 (53%)
CG15458NP_652293.1 ATP_synth_reg <11..38 CDD:291621 17/28 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - P PTHR34038
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.