powered by:
Protein Alignment Neb-cGP and CG15459
DIOPT Version :9
Sequence 1: | NP_001259408.1 |
Gene: | Neb-cGP / 50417 |
FlyBaseID: | FBgn0083167 |
Length: | 48 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608389.2 |
Gene: | CG15459 / 33036 |
FlyBaseID: | FBgn0031108 |
Length: | 302 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 23/40 - (57%) |
Similarity: | 29/40 - (72%) |
Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GLSKIFNGTTMSGRANVAKATYAVMGLL-IAYQVLKPKKK 48
|..|.|||||::|||||||||||.:.|| |.|::.:...|
Fly 4 GFKKYFNGTTINGRANVAKATYATLALLFIVYKLRRGSGK 43
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I12381 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108639 |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34038 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.910 |
|
Return to query results.
Submit another query.