DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neb-cGP and Atp5mk

DIOPT Version :9

Sequence 1:NP_001259408.1 Gene:Neb-cGP / 50417 FlyBaseID:FBgn0083167 Length:48 Species:Drosophila melanogaster
Sequence 2:NP_598228.1 Gene:Atp5mk / 171069 RGDID:631426 Length:58 Species:Rattus norvegicus


Alignment Length:51 Identity:23/51 - (45%)
Similarity:32/51 - (62%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAG---EGE-KLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
            |||   :|: :.||:.|.||..|::||.|...|||..:.||:.|..|:|||
  Rat     1 MAGPESDGQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRPKK 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neb-cGPNP_001259408.1 ATP_synth_reg 1..47 CDD:373426 21/49 (43%)
Atp5mkNP_598228.1 ATP_synth_reg 1..51 CDD:373426 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12118
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I5409
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1629213at2759
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 1 1.000 - - oto97611
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - LDO PTHR34038
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.