DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neb-cGP and atp5mk

DIOPT Version :9

Sequence 1:NP_001259408.1 Gene:Neb-cGP / 50417 FlyBaseID:FBgn0083167 Length:48 Species:Drosophila melanogaster
Sequence 2:XP_004915907.1 Gene:atp5mk / 101730293 XenbaseID:XB-GENE-988869 Length:59 Species:Xenopus tropicalis


Alignment Length:46 Identity:21/46 - (45%)
Similarity:28/46 - (60%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
            :|...:.||:.|.||..|::||.|...||||.:..||.:..|||||
 Frog     6 SGTHHQFTGIQKYFNAYTITGRRNCVLATYAGIAALILFFKLKPKK 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neb-cGPNP_001259408.1 ATP_synth_reg 1..47 CDD:373426 19/44 (43%)
atp5mkXP_004915907.1 ATP_synth_reg 1..51 CDD:373426 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12227
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1629213at2759
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 1 1.000 - - oto104297
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.