powered by:
Protein Alignment Neb-cGP and atp5mk
DIOPT Version :9
Sequence 1: | NP_001259408.1 |
Gene: | Neb-cGP / 50417 |
FlyBaseID: | FBgn0083167 |
Length: | 48 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915907.1 |
Gene: | atp5mk / 101730293 |
XenbaseID: | XB-GENE-988869 |
Length: | 59 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 21/46 - (45%) |
Similarity: | 28/46 - (60%) |
Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 AGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKK 47
:|...:.||:.|.||..|::||.|...||||.:..||.:..|||||
Frog 6 SGTHHQFTGIQKYFNAYTITGRRNCVLATYAGIAALILFFKLKPKK 51
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I12227 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
43 |
1.000 |
Inparanoid score |
I5307 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1629213at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto104297 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.060 |
|
Return to query results.
Submit another query.