DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12659 and IES6

DIOPT Version :9

Sequence 1:NP_001259344.1 Gene:CG12659 / 50403 FlyBaseID:FBgn0040929 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_010870.1 Gene:IES6 / 856667 SGDID:S000000770 Length:166 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:34/106 - (32%)
Similarity:51/106 - (48%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KPKRSFK--RPFTFPKNCVYRPLRQISNMERSQKLSAE----QPTYFTLNAPPSLVPAKKYSDIS 64
            ||.|..|  |.....:|.....|...:|.......:|.    :.|||::.||||:.|||||.|::
Yeast    55 KPTRRHKSARQLISDENKRINALLTKANKAAESSTAARRLVPKATYFSVEAPPSIRPAKKYCDVT 119

  Fly    65 GLPAPYADPHTKLRFASADEY-ASMQHMPSDIVNGYLMVRG 104
            ||...|..|...:|:.:|:.| ..::.|...:...||.:||
Yeast   120 GLKGFYKSPTNNIRYHNAEIYQLIVKPMAPGVDQEYLKLRG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12659NP_001259344.1 YL1_C 11..105 CDD:413215 31/101 (31%)
IES6NP_010870.1 YL1_C 44..166 CDD:413215 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005681
OrthoInspector 1 1.000 - - oto99007
orthoMCL 1 0.900 - - OOG6_104604
Panther 1 1.100 - - LDO PTHR31200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R589
SonicParanoid 1 1.000 - - X4664
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.