DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12659 and ies6

DIOPT Version :9

Sequence 1:NP_001259344.1 Gene:CG12659 / 50403 FlyBaseID:FBgn0040929 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_593143.1 Gene:ies6 / 2541949 PomBaseID:SPAC222.04c Length:117 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:36/101 - (35%)
Similarity:54/101 - (53%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RPFTFP-------KNCVYRPLRQISNMERSQKLSAEQP---TYFTLNAPPSLVPAKKYSDISGLP 67
            |||..|       :|   |.||||...:..|    .:|   :|.::.||||::|..||.|::||.
pombe    17 RPFRNPNYKAQPRRN---RNLRQIIQNDPVQ----NEPSKFSYSSIEAPPSVLPQPKYCDVTGLL 74

  Fly    68 APYADPHTKLRFASADEYASMQHMPSDIVNGYLMVR 103
            |.|.||.|:||:.:.:.|..::.:||.....||.:|
pombe    75 AIYTDPKTRLRYHNKEIYGLIRELPSGADQEYLKLR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12659NP_001259344.1 YL1_C 11..105 CDD:413215 36/101 (36%)
ies6NP_593143.1 COG5195 1..117 CDD:227522 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2013
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005681
OrthoInspector 1 1.000 - - oto100493
orthoMCL 1 0.900 - - OOG6_104604
Panther 1 1.100 - - LDO PTHR31200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R589
SonicParanoid 1 1.000 - - X4664
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.