DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12659 and Ino80c

DIOPT Version :10

Sequence 1:NP_001259344.1 Gene:CG12659 / 50403 FlyBaseID:FBgn0040929 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_766213.1 Gene:Ino80c / 225280 MGIID:2443014 Length:191 Species:Mus musculus


Alignment Length:123 Identity:52/123 - (42%)
Similarity:72/123 - (58%) Gaps:19/123 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQNAKPKRSFKRPFTFP--------------KNCVYRPLRQISNMERSQKLSAEQPTYFTLNAP 51
            :|:.|||     .||..|              ||..::.|:||...||:.......|.||:::||
Mouse    73 VEKAAKP-----LPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILAAERALPWQLNDPNYFSIDAP 132

  Fly    52 PSLVPAKKYSDISGLPAPYADPHTKLRFASADEYASMQHMPSDIVNGYLMVRGYTSAV 109
            ||..|||||||||||.|.|.||.:||||::.:|::.::.:|||:|.|||.:|..||.|
Mouse   133 PSFKPAKKYSDISGLLANYTDPQSKLRFSTVEEFSYIRRLPSDVVTGYLALRKATSIV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12659NP_001259344.1 YL1_C 11..105 CDD:470478 45/107 (42%)
Ino80cNP_766213.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
YL1_C 65..186 CDD:470478 49/117 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.