DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12659 and ino80c

DIOPT Version :9

Sequence 1:NP_001259344.1 Gene:CG12659 / 50403 FlyBaseID:FBgn0040929 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_031750404.1 Gene:ino80c / 101731482 XenbaseID:XB-GENE-6046878 Length:137 Species:Xenopus tropicalis


Alignment Length:110 Identity:48/110 - (43%)
Similarity:67/110 - (60%) Gaps:14/110 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PFTFP--------------KNCVYRPLRQISNMERSQKLSAEQPTYFTLNAPPSLVPAKKYSDIS 64
            ||..|              ||..::.|:||..:||:.......|.||:::||||..|||||||||
 Frog    27 PFKHPHFLHSGIGGAAAGKKNRTWKNLKQILALERALPWQLNDPNYFSIDAPPSCKPAKKYSDIS 91

  Fly    65 GLPAPYADPHTKLRFASADEYASMQHMPSDIVNGYLMVRGYTSAV 109
            ||||.|.||.:||||::.:|:..::.:|:|:|.|||.:|..||.|
 Frog    92 GLPANYTDPQSKLRFSTIEEFNYIRMLPTDVVTGYLTLRKATSIV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12659NP_001259344.1 YL1_C 11..105 CDD:413215 45/104 (43%)
ino80cXP_031750404.1 YL1_C 28..137 CDD:413215 47/109 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.