DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32736 and SMIM4

DIOPT Version :9

Sequence 1:NP_727152.1 Gene:CG32736 / 50395 FlyBaseID:FBgn0052736 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_011532031.1 Gene:SMIM4 / 440957 HGNCID:37257 Length:159 Species:Homo sapiens


Alignment Length:64 Identity:30/64 - (46%)
Similarity:43/64 - (67%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKR----RQAKNYVEEQ 67
            |||:|...|||:|||:|||||.||:||..:|:.||...||:..||..::|    ||.:..:|::
Human    96 VRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32736NP_727152.1 UPF0640 4..69 CDD:291773 30/64 (47%)
SMIM4XP_011532031.1 UPF0640 93..157 CDD:291773 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156396
Domainoid 1 1.000 63 1.000 Domainoid score I10270
eggNOG 1 0.900 - - E1_2E0KA
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5377
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45265
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009660
OrthoInspector 1 1.000 - - oto91389
orthoMCL 1 0.900 - - OOG6_110738
Panther 1 1.100 - - LDO PTHR35250
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4760
SonicParanoid 1 1.000 - - X9790
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.