DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32736 and smim4

DIOPT Version :9

Sequence 1:NP_727152.1 Gene:CG32736 / 50395 FlyBaseID:FBgn0052736 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001289975.1 Gene:smim4 / 100332503 -ID:- Length:81 Species:Danio rerio


Alignment Length:63 Identity:27/63 - (42%)
Similarity:44/63 - (69%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKRRQAKNYVEEQ 67
            |.:::.:|...|||||||||||||:||.:|..:|:.|||..:|...||..::|:|::...:::
Zfish     5 SQNLKYMLSLVPGKKRFGVYRFLPVFFCIGGVMEWIMINVRIGRETFYDVYRRKQSERAYQQK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32736NP_727152.1 UPF0640 4..69 CDD:291773 27/63 (43%)
smim4NP_001289975.1 UPF0640 4..69 CDD:291773 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592014
Domainoid 1 1.000 63 1.000 Domainoid score I10282
eggNOG 1 0.900 - - E1_2E0KA
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5378
OMA 1 1.010 - - QHG45265
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009660
OrthoInspector 1 1.000 - - oto38898
orthoMCL 1 0.900 - - OOG6_110738
Panther 1 1.100 - - LDO PTHR35250
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4760
SonicParanoid 1 1.000 - - X9790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.