DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and Cers1

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_619588.1 Gene:Cers1 / 93898 MGIID:2136690 Length:350 Species:Mus musculus


Alignment Length:269 Identity:76/269 - (28%)
Similarity:133/269 - (49%) Gaps:32/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RRAQDKPSTLVKFCENTWRCIYYL--YSFIFGVIVLWDKPWFWDVKSCWYGY-PHQSISNDIWWY 185
            :|.:.:|....:..|:.|:.::||  :|:...:::....|:|.|..|.:|.: ...::..||...
Mouse    87 KRCRLQPRDAARLPESAWKLLFYLACWSYCAYLLLGTSYPFFHDPPSVFYDWRSGMAVPWDIAVA 151

  Fly   186 YMISMSFY-WSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFL 249
            |::..||| .|:..|.:.|..|||...|.:||:|||||::.|:....|.||.||..:||.:|:.|
Mouse   152 YLLQGSFYCHSIYATVYMDSWRKDSVVMLVHHVVTLLLIASSYAFRYHNVGLLVFFLHDVSDVQL 216

  Fly   250 EAAKLTKYAK-----YQKLCDAIFAI----FTVVWIVTRLGFYP-RIIYSSSVEAPRILPMFPAY 304
            |..||..|.|     |.:|...:..:    |...|...||.::| :::|::...:.:.:|..|.|
Mouse   217 EFTKLNIYFKARGGAYHRLHGLVANLGCLSFCFCWFWFRLYWFPLKVLYATCHCSLQSVPDIPYY 281

  Fly   305 YIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDLTD-----------SSGNAR 358
            :.||.|||:|:|:::.|...|:.....     :::|.:|  :.|||.:           ......
Mouse   282 FFFNILLLLLMVMNIYWFLYIVAFAAK-----VLTGQMR--ELEDLREYDTLEAQTAKPCKAEKP 339

  Fly   359 LTNGSARSK 367
            |.||..:.|
Mouse   340 LRNGLVKDK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039 1/6 (17%)
TLC 135..334 CDD:214789 65/212 (31%)
Cers1NP_619588.1 TLC 98..311 CDD:214789 65/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.