DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and LOH2

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_188557.1 Gene:LOH2 / 821460 AraportID:AT3G19260 Length:296 Species:Arabidopsis thaliana


Alignment Length:228 Identity:85/228 - (37%)
Similarity:141/228 - (61%) Gaps:9/228 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LVKFCENTWRCIYYLYSFIFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFY-WSL 196
            :||..|:.|:.:||.....|.:.|::.:||..|:|..::|:|:|.:...|..|||....|| :.:
plant    70 IVKCKESLWKLLYYAACDFFVLQVIYHEPWARDIKLYFHGWPNQELKLSIKLYYMCQCGFYVYGV 134

  Fly   197 TGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLEAAKLTKYAKYQ 261
            .....::.:||||..|..||::|::|:|.|::.:..|:|:::|.:||.:|:|:|.||:.||::.:
plant   135 AALLAWETRRKDFAVMMSHHVITIILLSYSYLTSFFRIGAIILALHDASDVFMETAKIFKYSEKE 199

  Fly   262 KLCDAIFAIFTVVWIVTRLGFYP-RIIYSSSVEAPRILPMFPA-----YYIFNSLLLMLLVLHVI 320
            ......||:|.|.|::.||.::| .||.::|:|....|.|..|     ||.||::||||||.|:.
plant   200 FGASVCFALFAVSWLLLRLIYFPFWIIRATSIELLDYLDMTSAEGTLMYYSFNTMLLMLLVFHIY 264

  Fly   321 WTYMILKIVVDSLQ-KGLMSGDIRSSDSEDLTD 352
            |.|:|..::|..|: :|.:..||| |||||..|
plant   265 WWYLICAMIVRLLKNRGKVGEDIR-SDSEDDDD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039
TLC 135..334 CDD:214789 73/205 (36%)
LOH2NP_188557.1 TRAM_LAG1_CLN8 72..270 CDD:281751 71/197 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1449
eggNOG 1 0.900 - - E1_COG5058
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23634
Inparanoid 1 1.050 161 1.000 Inparanoid score I1625
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D987268at2759
OrthoFinder 1 1.000 - - FOG0000327
OrthoInspector 1 1.000 - - otm3330
orthoMCL 1 0.900 - - OOG6_100372
Panther 1 1.100 - - LDO PTHR12560
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X237
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.