DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and cers1

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_009294228.1 Gene:cers1 / 568169 ZFINID:ZDB-GENE-050208-406 Length:358 Species:Danio rerio


Alignment Length:258 Identity:75/258 - (29%)
Similarity:131/258 - (50%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RWWRLRRAQDKPSTLVKFCENTWRCIYYLYSFIFGVIVLW--DKPWFWDVKSCWYGYPH-QSISN 180
            :|.|:     :|..:.|..|:.|:.::|..|:.:...:|:  ...:|.:..|.:|.:.. .|:..
Zfish    91 QWCRI-----QPKDVSKMPESAWKLVFYTMSWSYSTYLLFFTSYSFFQNPPSVFYDWKSGMSVPT 150

  Fly   181 DIWWYYMISMSFY-WSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDC 244
            ||...|:|..||| .|:..|.:.|..|||...|.:||.:||.|::.|:....|.:|.|||.:||.
Zfish   151 DIAIAYLIQGSFYGHSIYATVYMDEWRKDSLVMVVHHFITLALITFSYAFRYHNIGILVLFLHDI 215

  Fly   245 ADIFLEAAKLTKYAKYQ---------KLCDAIFAIFTVVWIVTRLGFYP-RIIYSSSVEAPRILP 299
            .|:.||..|:..|.|.:         .|.:.....|::.|...||.::| :::::|.:.:.:.:|
Zfish   216 NDVQLEFTKINVYFKTRGGKEYFINDVLSNMGAVSFSITWFWFRLYWFPLKVLWASCITSIQSVP 280

  Fly   300 MFPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMS--GDIRSSDSEDL---TDSSGNA 357
            ..|.|:.||.||..||::::.| ::.:.:.|..:..|.|.  .|:|..|.:||   .|||..|
Zfish   281 NIPFYFFFNMLLFALLLMNIYW-FLFIVLFVAKVLTGQMKEVNDVREYDEDDLKERKDSSDEA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039 2/11 (18%)
TLC 135..334 CDD:214789 61/212 (29%)
cers1XP_009294228.1 TRAM_LAG1_CLN8 102..307 CDD:281751 60/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D987268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.