DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and CERS3

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001277270.1 Gene:CERS3 / 204219 HGNCID:23752 Length:394 Species:Homo sapiens


Alignment Length:354 Identity:142/354 - (40%)
Similarity:208/354 - (58%) Gaps:26/354 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFAAVVMLVRYTLERFWISPVGKS 71
            |...||....||||...|:|:.  ....:|......|...||:|.:::::|...|:|..||:.||
Human    16 FKEWFWLERFWLPPTIKWSDLE--DHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFVASPLAKS 78

  Fly    72 LGIRSSRPKKAANVPILEKTYAKSTRLD-KKKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVK 135
            .||:.:..|...|. :||..:..|||.. :..:..|:|:.:::||::|||:|.||.|::||.|.|
Human    79 FGIKETVRKVTPNT-VLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSRRNQERPSRLKK 142

  Fly   136 FCENTWRCIYYLYSFIFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ 200
            |.|..||..:||...:.|:..|:||||.:|:...|.|||.|.:....:|||::.|||||||....
Human   143 FQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYWYYILEMSFYWSLLFRL 207

  Fly   201 FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLEAAKLTKYAKYQKLCD 265
            .||||||||....|||:..:.|||.||..|..|.|:||::|||.|||:||:||:..||.:.:.|:
Human   208 GFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDVADIWLESAKMFSYAGWTQTCN 272

  Fly   266 AIFAIFTVVWIVTRLGFYP-RIIYSSSVEAPRILPMF---PAY-YIFNSLLLMLL-VLHVIWTYM 324
            .:|.||:.::.::||..:| .|:|.:     .||||:   |.: |||.:|.||:| |||:.|.|.
Human   273 TLFFIFSTIFFISRLIVFPFWILYCT-----LILPMYHLEPFFSYIFLNLQLMILQVLHLYWGYY 332

  Fly   325 ILK-----IVVDSLQKGLMSGDIRSSDSE 348
            |||     |.:.|:|      |:||.|.:
Human   333 ILKMLNRCIFMKSIQ------DVRSDDED 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039 18/56 (32%)
TLC 135..334 CDD:214789 93/209 (44%)
CERS3NP_001277270.1 homeodomain <93..139 CDD:238039 17/45 (38%)
TRAM_LAG1_CLN8 142..335 CDD:281751 89/197 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158723
Domainoid 1 1.000 56 1.000 Domainoid score I10988
eggNOG 1 0.900 - - E1_COG5058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383274at33208
OrthoFinder 1 1.000 - - FOG0000327
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X237
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.