DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and lagr-1

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_493403.1 Gene:lagr-1 / 189370 WormBaseID:WBGene00006505 Length:360 Species:Caenorhabditis elegans


Alignment Length:271 Identity:75/271 - (27%)
Similarity:126/271 - (46%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IERWWRLRRAQDKPSTLVKFCENTWRCIYY----LYSFIFGVIV----LWDKP---WF-WD---- 165
            :|.|.:.....  |....|..|:.|:..||    :::|.|.:.|    :::.|   |. |:    
 Worm    87 LESWTQQHNIY--PRFAHKVPESFWKLTYYGTVWIFAFYFHMCVDSHDIFNDPLSMWIEWESGGR 149

  Fly   166 VKSCWYGYPHQSISNDIWWYYMISMSFY-WSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVC 229
            .|..|          .:...|.:..:|| .|:..|.|.|:.|||.|.||:||.:.|.|:.||:|.
 Worm   150 PKMHW----------QVQVIYAVQSAFYIHSIYATLFMDLWRKDSWLMFVHHFIALGLLFLSYVD 204

  Fly   230 NLHRVGSLVLVVHDCADIFLEAAKLTKYAK----------YQKLCDAIFAIFTVVWIVTRLGFYP 284
            |....|:|||.:||.:|..||..||:.|.|          |..:.:|.|.:|.::|::.||.:|.
 Worm   205 NFTLPGALVLFLHDNSDATLEITKLSFYLKKRTNRQYYKYYFLMGNAAFILFAIIWVIFRLYWYT 269

  Fly   285 -RIIYSSSVEA----PRILPMFPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRS 344
             :::|::...|    |:..|.||   :..::||::..::|.|...|.:::   .:..|...|...
 Worm   270 CKLLYATIYGAVYLGPQDAPFFP---LLGAMLLIIFAMNVYWFNFIARMI---WRVALTGEDPED 328

  Fly   345 SDSEDLTDSSG 355
            :...|.|..||
 Worm   329 NREWDTTAVSG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039 2/13 (15%)
TLC 135..334 CDD:214789 66/230 (29%)
lagr-1NP_493403.1 TLC 102..320 CDD:214789 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D987268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.