DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and CERS1

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001374368.1 Gene:CERS1 / 10715 HGNCID:14253 Length:363 Species:Homo sapiens


Alignment Length:288 Identity:86/288 - (29%)
Similarity:139/288 - (48%) Gaps:39/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 WWRLRRAQD-------------KPSTLVKFCENTWRCIYYLYSFIFGVIVLW--DKPWFWDVKSC 169
            |..||.|..             :|....|..|:.|:.::||.|:.:...:|:  |.|:|.|..|.
Human    70 WTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSV 134

  Fly   170 WYGY-PHQSISNDIWWYYMISMSFY-WSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLH 232
            :|.: |..::..||...|::..||| .|:..|.:.|..|||...|.:||:|||:|:..|:....|
Human   135 FYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRYH 199

  Fly   233 RVGSLVLVVHDCADIFLEAAKLTKYAK-----YQKL----CDAIFAIFTVVWIVTRLGFYP-RII 287
            .||.|||.:||.:|:.||..||..|.|     |.:|    .|.....|...|...||.::| :::
Human   200 NVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVL 264

  Fly   288 YSSSVEAPRILPMFPAYYIFNSLLLMLLVLHVIWTYMIL----KIVVDSLQ--KGLMSGD----- 341
            |::|..:.|.:|..|.|:.||:|||:|.::::.|...|:    |::...:.  |.|...|     
Human   265 YATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFLYIVAFAAKVLTGQVHELKDLREYDTAEAQ 329

  Fly   342 -IRSSDSEDLTDSSGNARLTNGSARSKN 368
             ::.|.:|:....|.......|.||.::
Human   330 SLKPSKAEEAVAQSSVTFFGTGGARCRH 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039 4/23 (17%)
TLC 135..334 CDD:214789 72/216 (33%)
CERS1NP_001374368.1 TLC 98..311 CDD:214789 72/212 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R648
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.