DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment schlank and cers4b

DIOPT Version :9

Sequence 1:NP_652526.1 Gene:schlank / 50392 FlyBaseID:FBgn0040918 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_005163700.1 Gene:cers4b / 100330155 ZFINID:ZDB-GENE-110719-2 Length:402 Species:Danio rerio


Alignment Length:348 Identity:140/348 - (40%)
Similarity:206/348 - (59%) Gaps:11/348 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILNEFSNVFWSTHIWLPPNTTWADI--APGSRPDVVHANYKDLIWPIPFAAVVMLVRYTLERF 63
            ||.|:.:   ||...|||||...|.|:  ..|||..:.    :||:..:|.|...:::||..||.
Zfish     1 MDALSRW---FWKQEIWLPPGIVWEDLEEMQGSRRPMP----RDLLLALPLALAFIMLRYAFERR 58

  Fly    64 WISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDKK-KLVPLSKQTDMSEREIERWWRLRRAQ 127
            ...|:.:.||::.....|....|.||..|.|::|...: ::..|.||..::.|::|.|:|.||..
Zfish    59 VAFPLSRVLGVKDPVRLKVTPSPSLEAFYTKNSRQPTQIEISGLVKQCGLTHRQVETWFRNRRNL 123

  Fly   128 DKPSTLVKFCENTWRCIYYLYSFIFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSF 192
            |:||...||||..||..:||.:|..|::.|.:..||||.:.||.|:|.|.:....:||||:.:||
Zfish   124 DRPSNTTKFCEACWRFAFYLVAFTAGLLSLINTAWFWDQRECWRGFPRQPLQELHYWYYMLELSF 188

  Fly   193 YWSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLEAAKLTKY 257
            ||||......|||||||.:..|||..|:.|:..|:..|..|:|:||::|||.:|..||:||:..|
Zfish   189 YWSLLLCVSVDVKRKDFKEQIIHHFATIFLLGFSYCSNYIRIGTLVMLVHDASDFLLESAKMFNY 253

  Fly   258 AKYQKLCDAIFAIFTVVWIVTRLGFYP-RIIYSSSVEAPRILPMFPAYYIFNSLLLMLLVLHVIW 321
            |.::|.||::|.||..|::||||..:| :|||::.|.:..:...|..||.||:|||:|..||:.|
Zfish   254 AGWKKTCDSLFVIFAAVFLVTRLLVFPSKIIYTTLVLSMEVFEPFLGYYFFNALLLVLQALHIYW 318

  Fly   322 TYMILKIVVDSLQKGLMSGDIRS 344
            .|:||::|...|..|.:..|.||
Zfish   319 AYLILRMVYKFLFLGKLDKDERS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
schlankNP_652526.1 homeodomain 75..131 CDD:238039 17/56 (30%)
TLC 135..334 CDD:214789 90/199 (45%)
cers4bXP_005163700.1 homeodomain <83..128 CDD:238039 16/44 (36%)
TLC 130..330 CDD:214789 90/199 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5058
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383274at33208
OrthoFinder 1 1.000 - - FOG0000327
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100372
Panther 1 1.100 - - O PTHR12560
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R648
SonicParanoid 1 1.000 - - X237
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.