Sequence 1: | NP_572285.2 | Gene: | Grip / 50391 | FlyBaseID: | FBgn0029830 | Length: | 1058 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004279.3 | Gene: | CYTIP / 9595 | HGNCID: | 9506 | Length: | 359 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 46/201 - (22%) |
---|---|---|---|
Similarity: | 76/201 - (37%) | Gaps: | 41/201 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 745 SNGGNQAANSWSTGVNSRSYVAPPNTQSLTTELPEEEDEQEQMYPGYELNRYASVDCTALPPPME 809
Fly 810 NKVYGSAASSSSKSSGSSLHQIIFTVRLEPKGGLLGITL----------AGSEDITKSITISGLV 864
Fly 865 EGGIAHKNGQIHVGDQLLAIDEHSVQGMPLSHATSLLQNLGDLVDLKILRSHDLANGSHLPQTQA 929
Fly 930 IYAKVQ 935 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Grip | NP_572285.2 | PDZ | 82..147 | CDD:294084 | |
PDZ_signaling | 183..254 | CDD:238492 | |||
PDZ_signaling | 278..375 | CDD:238492 | |||
PDZ | 496..>521 | CDD:294084 | |||
PDZ_signaling | 571..658 | CDD:238492 | |||
PDZ_signaling | 832..913 | CDD:238492 | 20/90 (22%) | ||
PDZ_signaling | 973..1055 | CDD:238492 | |||
CYTIP | NP_004279.3 | PDZ_signaling | 76..161 | CDD:238492 | 20/89 (22%) |
Interaction with CYTH1 | 166..188 | 3/14 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |