DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and PDZD3

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:XP_011541302.1 Gene:PDZD3 / 79849 HGNCID:19891 Length:571 Species:Homo sapiens


Alignment Length:416 Identity:92/416 - (22%)
Similarity:146/416 - (35%) Gaps:141/416 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 AGVFIASILPASIADRCGALSVGDQVLSIDDTMIEH----------TAFSPDEVMTILDTSTGRG 376
            ||..:..:.|.:.|.|.| |..||::|::::.::||          .|.||..::|:|       
Human   137 AGHVVCRVDPGTSAQRQG-LQEGDRILAVNNDVVEHEDYAVVVRRIRASSPRVLLTVL------- 193

  Fly   377 YTQMQIMPAHALARR-----GH--TTLG---SPK----------YSFSTLESRKS------STAG 415
                 ...||.:||.     .|  .|||   .|:          :.||.....:.      ||.|
Human   194 -----ARHAHDVARAQLGEDAHLCPTLGPGVRPRLCHIVKDEGGFGFSVTHGNQGPFWLVLSTGG 253

  Fly   416 RQRQRFARKSSLPLENPACGTPGS-----------------------TGGSMGTGGIHGSS---- 453
            .     |.::.:|        ||:                       ..|...|..:.|..    
Human   254 A-----AERAGVP--------PGARLLEVNGVSVEKFTHNQLTRKLWQSGQQVTLLVAGPEVEEQ 305

  Fly   454 --SLGMGLGLCRAE--SFPVLLDCSH------GAGIILSETVSGSGGSGAVAIAQIVPDSVADRS 508
              .||:.|....||  :.|....|.|      |.|.:|.|. .|..|.....:.::.|...|.::
Human   306 CRQLGLPLAAPLAEGWALPTKPRCLHLEKGPQGFGFLLREE-KGLDGRPGQFLWEVDPGLPAKKA 369

  Fly   509 GCIQAGDRIVAI---------------------------------NKMYSLDAAAMRQLLEGGSS 540
            | :|||||:||:                                 ::.:|:...:....||...:
Human   370 G-MQAGDRLVAVAGESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRFFSMVRLSPLLFLENTEA 433

  Fly   541 RNGASNGTPANWLELEIEFDMPDAVVPASGVFSVKLL----RAGKCGLGLSVSGSSHGGLVISDV 601
            .......:.|:.:|.| :..:.|..||:..:.|.:..    ..|..|..||...|. ..|.||.|
Human   434 PASPRGSSSASLVETE-DPSLEDTSVPSVPLGSRQCFLYPGPGGSYGFRLSCVASG-PRLFISQV 496

  Fly   602 KMGSPAHRSGSLRSGDILLAVDQHPV 627
            ..|..|.|:| |:.||::|.|:.:||
Human   497 TPGGSAARAG-LQVGDVILEVNGYPV 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492
PDZ_signaling 278..375 CDD:238492 17/62 (27%)
PDZ 496..>521 CDD:294084 10/57 (18%)
PDZ_signaling 571..658 CDD:238492 21/61 (34%)
PDZ_signaling 832..913 CDD:238492
PDZ_signaling 973..1055 CDD:238492
PDZD3XP_011541302.1 PDZ_signaling 113..193 CDD:238492 16/56 (29%)
PDZ_signaling 221..298 CDD:238492 12/89 (13%)
PDZ 326..411 CDD:214570 18/86 (21%)
PDZ_signaling 466..545 CDD:238492 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.