DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_067605.1 Gene:Slc9a3r1 / 59114 RGDID:708538 Length:356 Species:Rattus norvegicus


Alignment Length:207 Identity:49/207 - (23%)
Similarity:89/207 - (42%) Gaps:27/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   863 LVE-GGIAHKNGQIHVGDQLLAIDEHSVQGMPLSHATSLLQNLGDLVDLKILRSHDLANGSHLPQ 926
            ||| |..|.|:|.: .||:|:.::..:|:........|.::...:.|.|.::   |......|.:
  Rat    41 LVEPGSPAEKSGLL-AGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVV---DPETDEQLKK 101

  Fly   927 TQAIYAKVQRRPRSPSANTE---ASKESGSGNANGGGAVNGNSGSGKPRVFHVTLYKDKVYDDYG 988
            ......:...|.:..|.:||   |:....:|:.|.....:......:||:  .|:.|..  :.||
  Rat   102 LGVPIREELLRAQEKSEHTEPPAAADTKKAGDQNEAEKSHLERCELRPRL--CTMKKGP--NGYG 162

  Fly   989 FSVSDGLYERGVFINRIRSGGPADMCGLLKPFDRIMQVNEMKTQDFDCCL-------TVPLIAAA 1046
            |::.....:.|.||..:....||:..| |:..|||::||.:       |:       .|..|.|.
  Rat   163 FNLHSDKSKPGQFIRAVDPDSPAEASG-LRAQDRIVEVNGV-------CMEGKQHGDVVSAIKAG 219

  Fly  1047 GDKIEMIMQRSE 1058
            ||:.::::...|
  Rat   220 GDEAKLLVVDKE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492
PDZ_signaling 278..375 CDD:238492
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492 14/50 (28%)
PDZ_signaling 973..1055 CDD:238492 23/88 (26%)
Slc9a3r1NP_067605.1 PDZ_signaling 12..91 CDD:238492 14/50 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 6/28 (21%)
PDZ_signaling 149..228 CDD:238492 25/90 (28%)
EBP50_C 232..356 CDD:286142 49/207 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.