DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and CG34375

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:297 Identity:57/297 - (19%)
Similarity:94/297 - (31%) Gaps:120/297 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QDQQQQQQQQQESHNNSFNG-----HHHPPTDTA-----------LAPMLSVDRAMSPAQSEDSG 71
            |:|||||::||..|..|.:.     ::|.||..:           :|..||.....:.|..|:||
  Fly   338 QEQQQQQERQQLGHEKSASSESEYQNYHCPTGKSCSSHSYQLGQPVANKLSTVAMQALAVVENSG 402

  Fly    72 ----------LAPERGTTYATITLP-------RNALHLAITFAERNDLSYPPVVGSLNPVGHAAD 119
                      .||..|...   .||       |....|....:..:.|:...:.|:.        
  Fly   403 GASLSAGSHKQAPAAGVNQ---ELPLEAGSIGRREWQLLRHLSGDHRLAVLQIYGTF-------- 456

  Fly   120 FLAPGDRLH-----QIDGISTIGLSNQKVMNMLCAGGSDACPAIVEIEYSLPECTVSQNSLCVTS 179
                |:|||     .::|::.:.||                                        
  Fly   457 ----GERLHVRPQLPLEGVACLRLS---------------------------------------- 477

  Fly   180 KLAQITVERESGCLG-----------LTLRGGADYPLIVTHV--RPHGPVYKTGRIKPGDRLLRV 231
                    .||...|           :.:.||.::.:.:.|:  .||||.::|....||.|.|..
  Fly   478 --------EESSTFGHVRVHTFFLAVIAIGGGDEHAVFLWHLDHLPHGPTFETVIETPGHRFLGP 534

  Fly   232 DNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSV 268
                  ..:|..:...|:..|......||..:.:|::
  Fly   535 ------AHSLRCSWPEIRASGQFLTLRNLAAKCEVTI 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084 13/76 (17%)
PDZ_signaling 183..254 CDD:238492 18/83 (22%)
PDZ_signaling 278..375 CDD:238492
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492
PDZ_signaling 973..1055 CDD:238492
CG34375NP_001163693.1 PDZ 13..86 CDD:238080
RING 129..168 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.