DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Zasp67

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster


Alignment Length:213 Identity:44/213 - (20%)
Similarity:75/213 - (35%) Gaps:59/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GLTLRGGA--DYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHV-- 254
            |..|.|||  ||||.|..| ..|.:.....::..|.::|:::.:....|..||.::|...|.|  
  Fly    16 GFRLVGGADYDYPLTVVKV-TEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVFY 79

  Fly   255 ---------SGYTNL----TIEYDV--SVVQSVEFSMGPLLIEIERPMNDK---------LGLVL 295
                     ..|..|    |.|..:  |.:.::..|..|.|.::....|.:         |...|
  Fly    80 FGVYRENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPFVPLPREL 144

  Fly   296 CNYTAAVPA-------------------------SGSGSSTPSSGEKIEESAGVFIASILPASIA 335
            ...|.|.||                         ..:|...|...::    .|:.:.::....:.
  Fly   145 AAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNGHDAPGQADE----GGLPVENLYLPDLP 205

  Fly   336 DR-CGALSVGDQVLSIDD 352
            || |.|||...::..:::
  Fly   206 DRPCSALSERQEIKLVEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492 19/61 (31%)
PDZ_signaling 278..375 CDD:238492 18/110 (16%)
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492
PDZ_signaling 973..1055 CDD:238492
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 18/59 (31%)
DUF4749 653..>699 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.