DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Zasp66

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:450 Identity:82/450 - (18%)
Similarity:134/450 - (29%) Gaps:194/450 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 VKMGSPAHRSGSLRSGDILLAV---DQHPVQHFNVDALLK------------------EEGRSQN 644
            |::|||||  |.|..|||:..:   |...:.|.:...|.:                  .:|.:|.
  Fly    68 VQVGSPAH--GELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQE 130

  Fly   645 PSHSSSDFTTLTIKRIVLPDFLPMSSPIYSNCPASGINLGMGMGVSTSTDHDLYSSAYVTAGKYA 709
            ....|...:||.   .|.||.:|...|                            |.::      
  Fly   131 AGPGSRSNSTLP---PVTPDLMPHRGP----------------------------SPFL------ 158

  Fly   710 DCVSLKSRTPQPDYF----RVPSMDDASLQSV--QLRSGSG------------SNGGNQAANSWS 756
                     |.|.:|    ::|.  |...|:|  ||.|..|            :....|..:...
  Fly   159 ---------PGPSHFERALQLPV--DTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQ 212

  Fly   757 TGVNSRSY-----VAP--------PNTQSLTTELPEEEDEQEQMYPGYELNRYASVDCTALPPPM 808
            ..:.::.|     |.|        |.|:|.....|   :...:.:||::.  :.|:....:...|
  Fly   213 AAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYP---NPAVRAHPGHDY--HDSIMKQRVADTM 272

  Fly   809 ENKVYGS----------------------------------AASSSSKSSGSSLHQII------- 832
            .:||.||                                  |.|.|::...|.||:.:       
  Fly   273 LHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGY 337

  Fly   833 -FTVRLEPKGGLLGITLAGSEDITKSITISGLVEGGIAHKNGQIHVGDQLLAIDEHSVQGMPLSH 896
             .||:.:|:               .|.|...:.|.|.....||                      
  Fly   338 KKTVQYDPR---------------NSETYRAIQEEGGYSNYGQ---------------------- 365

  Fly   897 ATSLLQNLGDLVDLKILRSHDLANGSHLPQTQAIYAKVQRRPRS-PSANTEASKESGSGN 955
              |..|.:...|..|:.:.:.|     :|..:.:.|.|.|.|.: .:.:.|..::|||.|
  Fly   366 --SSPQEVTIPVQTKVYQPNRL-----VPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492
PDZ_signaling 278..375 CDD:238492
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492 19/77 (25%)
PDZ_signaling 832..913 CDD:238492 13/88 (15%)
PDZ_signaling 973..1055 CDD:238492
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 14/48 (29%)
DUF4749 285..359 CDD:292558 12/88 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.